Pheromone Biosynthesis Activating Neuropeptide

Cat.#: 303424

Sequence shortening:LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL

Sequence:H-Leu-Ser-Asp-Asp-Met-Pro-Ala-Thr-Pro-Ala-Asp-Gln-Glu-Met-Tyr-Arg-Gln-Asp-Pro-Glu-Gln-Ile-Asp-Ser-Arg-Thr-Lys-Tyr-Phe-Ser-Pro-Arg-Leu-NH2

Length(aa):33

Peptide Purity (HPLC):97.1%

Molecular Formula:C167H259N47O57S2

Molecular weight:3901.31

Source:Synthetic

Form:Powder

Description:A pheromone biosynthesis activating neuropeptide hormone which in the picomolar range induced sex pheromone synthesis in various moth species.

Storage Guidelines:Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

References:A.K.Raina et al., Science, 244, 796 (1989)

About TFA Salt:Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.

견적 문의: aibiohub@aibiohub.co.kr  홈페이지: www.aibiohub.co.kr 

견적 문의: https://aibiohub.co.kr/estimate/write