AI Bio 소식
[Creative Biomart 공식 대리점]Recombinant Human TMEM106B, GST-tagged(TMEM106B-3274H)
- AI바이오허브 오래 전 2025.07.15 21:51 제품소개 인기
-
126
0
Recombinant Human TMEM106B, GST-tagged
Cat.No. :TMEM106B-3274H
Product Overview :Recombinant Human TMEM106B(150-274 aa), fused with a GST tag at the N-terminus, was expressed in E. coli.
Species :Human
Source :E.coli
Tag :GST
Protein Length :150-274 aa
Form :Lyophilized from sterile PBS, pH7.4, 0.3% SKL, 5% Trehalose, 5% Mannitol.
Molecular Mass :The protein has a calculated MW of 40.72 kDa.
Endotoxin :<1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage :Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution :It is recommended that sterile water be added to the vial to prepare a stock solution of 0.86mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence :MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ
견적 문의: aibiohub@aibiohub.co.kr 홈페이지: www.aibiohub.co.kr
견적 문의: https://aibiohub.co.kr/estimate/write
- 이전글[Cymit Quimica 공식 대리점]CHLORHEXIDINE FOR SYSTEM SUITABILITY CRS(41-Y0001545)2025.07.15
- 다음글[Creative PEGWorks 공식 대리점]Hyaluronate Fluorescein, MW 500k(HA-802)2025.07.15
댓글목록
등록된 댓글이 없습니다.

