AI Bio 소식
[HMG Biotech 공식 대리점]SDF1 (CXCL12) labelled 15N and 13C for NMR (HM-161 )
- AI바이오허브 오래 전 2025.03.06 19:02 Bulletin Board 인기
-
351
0
SDF1 (CXCL12) labelled 15N and 13C for NMR
SKU: HM-161
Category: SDF-1 15N and 13C for NMR Tags: 15N HMGB1 labelled for NMR or Mass Spec, cxcl12, HMGB1, HMGB1 for
NMR, HMGB1 labelled, HMGB1 labelled 13C, HMGB1 LPS-free, sdf1
Description
SDF1 (CXCL12) labelled 15N and 13C for NMR, LPS-Free
SDF-1α for Mass Spectrometry is the 8 kDa protein labelled with isotope 15N and 13C .
This protein is suitable for NMR studies.
This product corresponds to the human sequence and is produced in E.coli.
SDF-1α we provide is the natural protein, with no tags or additional amino acids.
It has the sequence:
[“MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK”]
Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has
a calculated molecularmass of approximately 8 kDA
Purity: The purified protein is >95% homogeneous (electrophoresis). It contains no nucleic acids.
Endotoxin Level: The purified protein is free from LPS (Pierce™ Chromogenic Endotoxin Quant Kit, <0.1 EU/mL).
The product contains <0.006% v/v of Triton X-114 due to LPS removal procedure. The remaining traces of Triton
X-114 can be removed upon request.
Buffer & Reconstitution: the lyophilized protein once reconstituted with distilled water will be dissolved in a solution of DPBS
without Ca and Mg.
Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated
freezing and thawing.
This product is intended for research only, and cannot be used on humans.
Publications:
1.An 8-Hydroxy-Quinoline Derivative Protects Against Lipopolysaccharide-Induced Lethality in Endotoxemia by Inhibiting
HMGB1-Mediated Caspase-11 Signaling Lipopolysaccharide-Activated Canine Platelets Upregulate High Mobility Group
Box-1 via Toll-Like Receptor 4
2.A RAGE-antagonist peptide potentiates polymeric micelle-mediated intracellular delivery of plasmid DNA for acute
lung injury gene therapy The Time-Course of Antioxidant Irisin Activity: Role of the Nrf2/HO-1/HMGB1 Axis
3.Lipopolysaccharide-regulated secretion of soluble and vesicle-based proteins from a panel of colorectal cancer cell lines
High-mobility group box protein-1 induces acute pancreatitis through activation of neutrophil extracellular trap and
subsequent production of IL-1β Increased cell-free fetal DNA release after apoptosis and sterile inflammation in human
trophoblast cells.
4.Photodynamic Therapy in Combination with the Hepatitis B Core Virus-like Particles (HBc VLPs) to Prime Anticancer
Immunity for Colorectal Cancer Treatment
5.The protective mechanism of salidroside modulating miR-199a-5p/TNFAIP8L2 on lipopolysaccharide-induced MLE-12 cells
Inhibition of inflammatory liver injury by the HMGB1-A box through HMGB1/TLR-4/NF-κB signaling in an acute
liver failure mouse model
6.CXCL12 promotes the crossing of retinal ganglion cell axons at the optic chiasm
7.Ultrasound-targeted microbubble destruction promotes PDGF-primed bone mesenchymal stem cell transplantation
for myocardial protection in acute Myocardial Infarction in rats.
8.Biodegradable nano black phosphorus based SDF1-α delivery system ameliorates Erectile Dysfunction in a
cavernous nerve injury rat model by recruiting endogenous stem/progenitor cells
9.Methazolamide Reduces the AQP5 mRNA Expression and Immune Cell Migration-A New Potential Drug in Sepsis Therapy?
10.Correlations of Serum Retinol-Binding Protein and Stromal Cell-Derived Factor-1 with Renal Function in Patients
with Diabetic Kidney Disease
11.RNA Analysis of Circulating Leukocytes in Patients with Alzheimer’s Disease
12.Suggested mechanism of CCR5Δ32, CCR2-64I and SDF 1-3’A allele frequency change in Polish and Lithuanian gene pools
from the perspective of passing time
13.Molecular and Brain Volume Changes Following Aerobic Exercise, Cognitive and Combined Training in Physically
Inactive Healthy Late-Middle-Aged Adults: The Projecte Moviment Randomized Controlled Trial
Secondary damage and neuroinflammation in the spinal dorsal horn mediate post-thalamic hemorrhagic stroke pain
hypersensitivity: SDF1-CXCR4 signaling mediation
SDF1-CXCR4 Signaling Maintains Central Post-Stroke Pain through Mediation of Glial-Neuronal Interactions
14.The importance of the CXCL12/CXCR4 axis in therapeutic approaches to Diabetes mellitus attenuation
15.Peroxynitrite Exposure of CXCL12 Impairs Monocyte, Lymphocyte and Endothelial Cell Chemotaxis, Lymphocyte
Extravasation in vivo and Anti-HIV-1 Activity
16.Upregulation of C-X-C motif chemokine 12 in the spinal cord alleviated the symptoms of experimental autoimmune
encephalomyelitis in Lewis rats
17.Disruption of placental ACKR3 impairs growth and hematopoietic development of offspring
18.Study on the mechanism of CXCL12/CXCR4-axis-mediated upregulation of IL-8 and IL-6 on the biological function
of acute T lymphocyte leukaemia cells
19.CXCL12-CXCR4 mediates CD57+ CD8+ T cell responses in the progression of type 1 diabetes
Zebrafish tsc1 and cxcl12a increase susceptibility to mycobacterial infection
20.Advance in the role of chemokines/chemokine receptors in carcinogenesis: Focus on pancreatic cancer
21.Combined bioinformatics and machine learning methodologies reveal prognosis-related ceRNA network and
propose ABCA8, CAT, and CXCL12 as independent protective factors against osteosarcoma
Single-cell analysis reveals alterations in cellular composition and cell-cell communication associated with airway
inflammation and remodeling in asthma
22.Up-regulation of LINC00665 contributes to the progression of glioma and correlates with its MRI characteristics
23.Pamoic acid is an inhibitor of HMGB1·CXCL12 elicited chemotaxis and reduces inflammation in murine models of
Pseudomonas aeruginosa pneumonia
24.DNA-mediated proteolysis by neutrophil elastase enhances binding activities of the HMGB1 protein
Design, synthesis and biological evaluation of liposome entrapped iridium(III) complexes toward SGC-7901 cells
25.The correlation between the severity of cerebral microbleeds and serum HMGB1 levels and cognitive
impairment in patients with cerebral small vessel disease
26.Integrated approaches for the recognition of small molecule inhibitors for Toll-like receptor 4
Serum biomarkers of hypoxic-ischemic brain injury
27.The Anti-inflammatory Effects of HMGB1 Blockades in a Mouse Model of Cutaneous Vasculitis
Nonoxid-HMGB1 Attenuates Cognitive Impairment After Traumatic Brain Injury in Rats
28.Discovery of 5,5′-Methylenedi-2,3-Cresotic Acid as a Potent Inhibitor of the Chemotactic Activity of the
HMGB1·CXCL12 Heterocomplex Using Virtual Screening and NMR Validation
- 이전글[ASCA Gmbh 공식 대리점](2-Hydroxyethyl)-phosphonic acid(10005)2025.03.06
- 다음글[Haworks 공식 대리점]Hyaluronate DyLight®, MW 100 kDa (HA-DyLight-100k)2025.03.06
댓글목록
등록된 댓글이 없습니다.
